Bacterial taxon 909946
Locus STM474_2738
Protein WP_000788827.1
Replication protein 14
Salmonella enterica Serovar Typhimurium ST4 74
Length 230 aa, Gene n/a, UniProt E8XHL0
>WP_000788827.1|Salmonella enterica Serovar Typhimurium ST4 74|Replication protein 14
MKNIAAQMVNFDREQMRRIANNMPEQHDDKPQVEQVAKVINNVFSQLMAAFPATTANRSQAEMNEIRRQWVLAFRENGITTMEQVAAGMRVARRQERPFLPSPGQFVAWCREGSGALGVSVDDIMGEYWRWRKLVFRYPTSEQFPWRDKNPLYYHVCLELRRRGMEGQLSEKELIRAAGDILHEWEKRVLAGKPIPPVRRALAAPSRDRGPTPAEMLMAKYKQRKDAGLI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,766,319 | 1.74 | 0.018 | ○○○○○ 1.08 | 1.08217511360714 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,766,319 | -0.07 | 0.97 | ○○○○○ 0.14 | 0.139004936750885 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,766,314 | 0.29 | 0.72 | ○○○○○ 0.33 | 0.328578366547561 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,766,314 | 0.4 | 0.95 | ○○○○○ 0.39 | 0.386498734558755 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,766,314 | 0.43 | 0.74 | ○○○○○ 0.4 | 0.397913420162096 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,766,319 | 0.94 | 0.75 | ○○○○○ 0.67 | 0.666678652279815 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)