Bacterial taxon 909946
Locus STM474_3774
Protein WP_001196084.1
response regulator transcription factor
Salmonella enterica Serovar Typhimurium ST4 74
Length 200 aa, Gene yhjB, UniProt E8XFB9
>WP_001196084.1|Salmonella enterica Serovar Typhimurium ST4 74|response regulator transcription factor
MQVIMFDRQSIFIHGMKISLQQHIPGISIQSVGQAEELWQKIESAPDALVMLDSGLDAEFCREVLQRTAQQFPEVKIIITAMDGSQKWLHEVMQFNVQAVVPRDSDAETFVLALNAVARGMMFLPGDWLNSTELESRDIKALSARQREILQMLAAGESNKQIGRALNISTGTVKAHLESLYRRLDVKNRTQAAMMLNESN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,801,301 | -6.49 | 1.9e-21 | ●●●●○ -3.19 | -3.19493496361243 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,801,061 | -5.5 | 5.5e-15 | ●●●○○ -2.68 | -2.68056727634793 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,801,061 | -5.07 | 5.4e-6 | ●●●○○ -2.46 | -2.45756867531579 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,801,301 | -4.33 | 0.00023 | ●●●○○ -2.07 | -2.07123095096742 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,801,301 | -1.38 | 0.36 | ●○○○○ -0.54 | -0.540973059377654 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,801,061 | -1.19 | 0.5 | ●○○○○ -0.44 | -0.442145675547289 | 23637626 |
Retrieved 6 of 6 entries in 1.8 ms
(Link to these results)