Bacterial taxon 909946
Locus STM474_4751
Protein WP_000936657.1
response regulator transcription factor
Salmonella enterica Serovar Typhimurium ST4 74
Length 241 aa, Gene yjjQ, UniProt E8XCJ3
>WP_000936657.1|Salmonella enterica Serovar Typhimurium ST4 74|response regulator transcription factor
MLPGCCKNGLIISKTPLIQEGLKGAITGNFPDYKLAYCRTIEELTLLQLRRSNLVIADLAVNNASPRAICEYFYSLLSQYRDIHWVFLVPKSCYPHAVDLLMGPVSTLLSDEEPIENLISVIHAGNARSERISKTLLSPQVPSEIQQSHDRPIVLTLSERKVLRLLGKGWGINQIAALLKKSNKTISAQKNSAMRRLSIHSNAEMYAWINSSQGARELNLPSVYGETMEWKTESAREMLRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,827,299 | -5.77 | 9.5e-11 | ●●●○○ -2.82 | -2.81865209355431 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,827,299 | -5.54 | 2.1e-6 | ●●●○○ -2.7 | -2.70016176448327 | 23637626 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)