Bacterial taxon 909946
Locus STM474_4225
Protein WP_001179685.1
rhamnulose-1-phosphate aldolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 275 aa, Gene rhaD, UniProt E8XKB0
>WP_001179685.1|Salmonella enterica Serovar Typhimurium ST4 74|rhamnulose-1-phosphate aldolase
MQNITDSWFVQGMIKATSDAWLKGWDERNGGNLTLRLDEADIAPFAANFHEKPRYIALSQPMPLLANTPFIVTGSGKFFRNVQLDPAANLGVVKIDSDGAGYHILWGLTHDAVPTSELPAHFLSHCERIKATHGKDRVIMHCHATNLIALTYVLENNTALITRKLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAEVLVKIYSMGGMKQTITREELVALGKRFGVTPLASAVALY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,276,603 | 1.64 | 0.0072 | ○○○○○ 1.03 | 1.03036549181433 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,276,786 | -0.96 | 0.18 | ●○○○○ -0.32 | -0.320440815348876 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,276,603 | 0.18 | 0.99 | ○○○○○ 0.27 | 0.269456503685556 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,276,786 | 0.24 | 0.98 | ○○○○○ 0.3 | 0.302133788497372 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,276,895 | 0.44 | 0.59 | ○○○○○ 0.4 | 0.403623148435944 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,276,603 | 0.44 | 0.77 | ○○○○○ 0.41 | 0.405946514727067 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,277,250 | 0.69 | 0.85 | ○○○○○ 0.54 | 0.538022280001263 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,276,895 | 0.76 | 0.82 | ○○○○○ 0.57 | 0.573450850589989 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,276,786 | 1.02 | 0.62 | ○○○○○ 0.71 | 0.705994557377683 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,277,250 | 1.05 | 0.2 | ○○○○○ 0.72 | 0.724029264529607 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,277,250 | 1.24 | 0.3 | ○○○○○ 0.82 | 0.821154750151679 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,276,895 | 1.41 | 0.55 | ○○○○○ 0.91 | 0.91050079684974 | 23637626 |
Retrieved 12 of 12 entries in 1 ms
(Link to these results)