Bacterial taxon 909946
Locus STM474_3876
Protein WP_001156179.1
rhodanese-like domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 143 aa, Gene n/a, UniProt E8XG17
>WP_001156179.1|Salmonella enterica Serovar Typhimurium ST4 74|rhodanese-like domain-containing protein
MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSEIKANNVGELEKHKDKPIIVVDGSGMQCQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,918,596 | 0.33 | 0.95 | ○○○○○ 0.35 | 0.347458420955721 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,918,596 | 0.36 | 0.66 | ○○○○○ 0.36 | 0.362623039221005 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,918,596 | 0.48 | 0.78 | ○○○○○ 0.43 | 0.427560570040916 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)