Bacterial taxon 909946 
						  Locus STM474_3967 
						  Protein WP_000350272.1 
					
				
				ribokinase
				Salmonella enterica Serovar Typhimurium ST4 74 
				Length 306 aa, Gene rbsK, UniProt E8XHM7 
					
				
				
					>WP_000350272.1|Salmonella enterica Serovar Typhimurium ST4 74|ribokinase
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKVGDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPEDIDRAAEDLKKCQLIVLQLEVQLETVYHAIEFGKKHGIEVLLNPAPALRELDMSYACKCDFFVPNETELEILTGMPVDTYDHIRAAARSLVDKGLNNIIVTMGEKGALWMTRDQEVHVPAFRVNAVDTSGAGDAFIGCFAHYYVQSGDVEAAMKKAVLFAAFSVTGKGTQSSYPSIEQFNEYLSLNE
				
				 
				
			
		    
            
              
            	| Host | Tissue | Tissue Ontology | Time Post Infection | Transposon Insertion Site | Raw Fitness Score | p-Value | Fitness z-Score | Precise fitness z-Score | Reference | 
            
            
            
            | Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,015,646 | -7.19 | 3.4e-25 | ●●●●○ -3.55 | -3.55473466078425 | 23637626 | 
            
            | Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,015,646 | -5.34 | 8.8e-6 | ●●●○○ -2.6 | -2.59699888065421 | 23637626 | 
            
            | Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,015,148 | -5.03 | 3.0e-17 | ●●●○○ -2.44 | -2.43715119642301 | 23637626 | 
            
            | Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,015,157 | -4.58 | 7.7e-13 | ●●●○○ -2.2 | -2.20127067847737 | 23637626 | 
            
            | Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,015,093 | -4.54 | 9.3e-29 | ●●●○○ -2.18 | -2.18193932970845 | 23637626 | 
            
            | Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,015,143 | -4.2 | 4.3e-15 | ●●●○○ -2.01 | -2.00572448178748 | 23637626 | 
            
            | Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,015,039 | -3.97 | 2.3e-11 | ●●○○○ -1.88 | -1.88354681980908 | 23637626 | 
            
            | Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,015,157 | -3.25 | 0.00032 | ●●○○○ -1.51 | -1.51137636928229 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,015,646 | -3.1 | 0.0034 | ●●○○○ -1.43 | -1.43308744026723 | 23637626 | 
            
            | Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,015,148 | -1.85 | 0.047 | ●○○○○ -0.78 | -0.784132849697339 | 23637626 | 
            
            | Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,015,093 | -1.84 | 0.048 | ●○○○○ -0.78 | -0.780085775537526 | 23637626 | 
            
            | Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,015,070 | -1.75 | 0.00018 | ●○○○○ -0.73 | -0.733712127339902 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,015,039 | -1.65 | 0.21 | ●○○○○ -0.68 | -0.680335642149494 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,015,157 | -1.1 | 0.53 | ●○○○○ -0.4 | -0.395719579159275 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,015,143 | -1.02 | 0.78 | ●○○○○ -0.35 | -0.350452915206816 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,015,093 | -0.64 | 0.89 | ●○○○○ -0.15 | -0.153184766970629 | 23637626 | 
            
            | Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,015,070 | -0.47 | 0.71 | ●○○○○ -0.07 | -0.0685170998939976 | 23637626 | 
            
            | Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,015,546 | -0.3 | 0.68 | ○○○○○ 0.02 | 0.0205818926918547 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,015,546 | -0.2 | 0.95 | ○○○○○ 0.07 | 0.0741937479325315 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,015,070 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.162589121000986 | 23637626 | 
            
            | Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,015,546 | 0.21 | 0.9 | ○○○○○ 0.29 | 0.288474224791425 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,015,148 | 0.53 | 0.9 | ○○○○○ 0.45 | 0.451523390809646 | 23637626 | 
            
            | Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,015,143 | 0.86 | 0.52 | ○○○○○ 0.63 | 0.625332154432563 | 23637626 | 
              
          
		   Retrieved 23 of 23 entries in 1.6 ms
			  (Link to these results)