Bacterial taxon 909946
Locus STM474_4272
Protein WP_000872918.1
ribonuclease E activity regulator RraA
Salmonella enterica Serovar Typhimurium ST4 74
Length 161 aa, Gene menG, UniProt E8XKF7
>WP_000872918.1|Salmonella enterica Serovar Typhimurium ST4 74|ribonuclease E activity regulator RraA
MKYDTSELCDIYQEDVNVVEPLFSNFGGRSSFGGQIITVKCFEDNGLLYDLLEQNGRGRVLLVDGGGSVRRALVDAELARLATQNEWEGLVIYGAVRQVDDLEELDIGIQAIAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,319,227 | 0.33 | 0.69 | ○○○○○ 0.35 | 0.347115766196264 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,319,227 | 0.52 | 0.91 | ○○○○○ 0.45 | 0.447022350414829 | 23637626 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)