Bacterial taxon 909946
Locus STM474_0054
Protein WP_000127283.1
ribonucleoside hydrolase RihC
Salmonella enterica Serovar Typhimurium ST4 74
Length 306 aa, Gene rihC, UniProt E8XG73
>WP_000127283.1|Salmonella enterica Serovar Typhimurium ST4 74|ribonucleoside hydrolase RihC
MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSVEKTTRNALQLLHFWNSDIPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLAKPAFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNFTPNAEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHSLFNHYRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGQYTAGTTVVDIEGRLGQPANAQVALALDVDGFRQWVAEVFAYAP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 60,719 | -1 | 0.12 | ●○○○○ -0.34 | -0.344614775462242 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 60,957 | 0.06 | 1 | ○○○○○ 0.21 | 0.209210703029958 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 60,719 | 0.93 | 0.76 | ○○○○○ 0.66 | 0.65862732353631 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 60,957 | 1.28 | 0.11 | ○○○○○ 0.84 | 0.842010777863977 | 23637626 |
Retrieved 4 of 4 entries in 1.8 ms
(Link to these results)