Bacterial taxon 909946
Locus STM474_3457
Protein WP_000196654.1
ribosome assembly RNA-binding protein YhbY
Salmonella enterica Serovar Typhimurium ST4 74
Length 110 aa, Gene yhbY, UniProt E8XCB4
>WP_000196654.1|Salmonella enterica Serovar Typhimurium ST4 74|ribosome assembly RNA-binding protein YhbY
MTRFQSQRKQKYTMNLSTKQKQHLKGLAHPLKPVVMLGNNGLTEGVLAEIEQALEHHELIKVKIASEDRETKTLIVDAIVRETGACNVQVIGKTLVLYRPTKERKISLPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,488,995 | -0.3 | 0.93 | ○○○○○ 0.02 | 0.0189000005639279 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,488,995 | 0.44 | 0.59 | ○○○○○ 0.4 | 0.403442559337799 | 23637626 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)