Bacterial taxon 909946
Locus STM474_4633
Protein WP_000166287.1
ribosome-associated protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 183 aa, Gene yjgA, UniProt E8XBI9
>WP_000166287.1|Salmonella enterica Serovar Typhimurium ST4 74|ribosome-associated protein
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,702,149 | -3.73 | 0.0005 | ●●○○○ -1.76 | -1.76010573158334 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,702,149 | -2.23 | 3.0e-11 | ●○○○○ -0.98 | -0.979704516697102 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,702,149 | -2.12 | 0.031 | ●○○○○ -0.92 | -0.923483185989395 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)