Bacterial taxon 909946
Locus STM474_1629
Protein WP_000600616.1
ribulose-phosphate 3 epimerase family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 210 aa, Gene n/a, UniProt E8XJU7
>WP_000600616.1|Salmonella enterica Serovar Typhimurium ST4 74|ribulose-phosphate 3 epimerase family protein
MILHPSLASADPLRYAEALTALHDAPLGSLHLDIEDTSFINNITFGMKTIQAVAQYTRHPLSFHLMVSSPQRWLPWLAAIRPGWIFIHAESVQNPPEILADIRAIGAKAGLALNPATPLLPYRYLALQLDALMIMTSEPDGRGQQFIAAMCEKVSQGREHFPAAECWADGGITLRAARLLAAAGAQHLVIGRALFTTANYDVTLSQFTAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,663,003 | -0.47 | 0.72 | ●○○○○ -0.07 | -0.0650142000523599 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,663,003 | -0.41 | 0.47 | ●○○○○ -0.04 | -0.035283642516659 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,663,003 | -0.13 | 0.97 | ○○○○○ 0.11 | 0.109740010297483 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)