Bacterial taxon 909946
Locus STM474_1560
Protein WP_000194089.1
RidA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 129 aa, Gene n/a, UniProt E8XIZ6
>WP_000194089.1|Salmonella enterica Serovar Typhimurium ST4 74|RidA family protein
MTQRIAVFPADRHSLYEEHGYSAAIRSGDLLFVSGQVGSHTDGTPEPDFQKQVRLAFENLKATLTAAGCTFDDIVDVTTFHTDPEQQLNDVMAVKQEIFAHPPYPNWTAVGVTWLAGFDFEIKVIARIP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,582,939 | -0.29 | 0.83 | ○○○○○ 0.03 | 0.0254618167991086 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,582,939 | -0.1 | 0.97 | ○○○○○ 0.12 | 0.123244262030084 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,582,939 | 0.69 | 0.36 | ○○○○○ 0.54 | 0.537179086862496 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)