Bacterial taxon 909946
Locus STM474_0197
Protein WP_001294181.1
RNA 2',3'-cyclic phosphodiesterase
Salmonella enterica Serovar Typhimurium ST4 74
Length 176 aa, Gene ligT, UniProt E8XHY6
>WP_001294181.1|Salmonella enterica Serovar Typhimurium ST4 74|RNA 2',3'-cyclic phosphodiesterase
MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHLTLAFLGDVSSDKQRSLAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQLANMLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYGQGRTRYAELQRWTLGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 217,770 | 0.58 | 0.64 | ○○○○○ 0.48 | 0.476782210803057 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 217,770 | 1.05 | 0.8 | ○○○○○ 0.72 | 0.724974981819503 | 23637626 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)