Bacterial taxon 909946
Locus STM474_3821
Protein WP_000014594.1
RNA chaperone/antiterminator CspA
Salmonella enterica Serovar Typhimurium ST4 74
Length 70 aa, Gene cspA, UniProt E8XFW4
>WP_000014594.1|Salmonella enterica Serovar Typhimurium ST4 74|RNA chaperone/antiterminator CspA
MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,857,807 | -0.01 | 1 | ○○○○○ 0.17 | 0.171288126083416 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,857,852 | 0.29 | 0.72 | ○○○○○ 0.33 | 0.326583313101207 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,857,852 | 0.36 | 0.95 | ○○○○○ 0.36 | 0.363788895579675 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,857,807 | 0.67 | 0.86 | ○○○○○ 0.53 | 0.525776327321755 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,857,807 | 1.21 | 0.13 | ○○○○○ 0.8 | 0.803536803450786 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,857,852 | 1.42 | 0.34 | ○○○○○ 0.91 | 0.912410769407177 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)