Bacterial taxon 909946 
						  Locus STM474_3150 
						  Protein WP_000564481.1 
					
				
				RNA pyrophosphohydrolase
				Salmonella enterica Serovar Typhimurium ST4 74 
				Length 176 aa, Gene ygdP, UniProt E8X8T7 
					
				
				
					>WP_000564481.1|Salmonella enterica Serovar Typhimurium ST4 74|RNA pyrophosphohydrolase
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG
				
				 
				
			
		    
            
              
            	| Host | Tissue | Tissue Ontology | Time Post Infection | Transposon Insertion Site | Raw Fitness Score | p-Value | Fitness z-Score | Precise fitness z-Score | Reference | 
            
            
            
            | Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,184,066 | -6.97 | 2.1e-25 | ●●●●○ -3.44 | -3.44371581077506 | 23637626 | 
            
            | Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,184,066 | -4.47 | 4.8e-5 | ●●●○○ -2.15 | -2.14650925778087 | 23637626 | 
              
          
		   Retrieved 2 of 2 entries in 0.8 ms
			  (Link to these results)