Bacterial taxon 909946
Locus STM474_3150
Protein WP_000564481.1
RNA pyrophosphohydrolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 176 aa, Gene ygdP, UniProt E8X8T7
>WP_000564481.1|Salmonella enterica Serovar Typhimurium ST4 74|RNA pyrophosphohydrolase
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLMSADAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMALQDNPPKLQSAPAYRRKRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,184,066 | -6.97 | 2.1e-25 | ●●●●○ -3.44 | -3.44371581077506 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,184,066 | -4.47 | 4.8e-5 | ●●●○○ -2.15 | -2.14650925778087 | 23637626 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)