Bacterial taxon 909946
Locus STM474_3853
Protein WP_001188274.1
ROK family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 293 aa, Gene n/a, UniProt E8XFZ5
>WP_001188274.1|Salmonella enterica Serovar Typhimurium ST4 74|ROK family protein
MQQYIGIDVGGTHVKYGVINSDGEELTHHQFDTPEDASTFTRKWQDVVARCQQDYDIAAIGVSFPGHINPHNGHAAKAGALAYLDDVNLMELFSGLTDLPLVVENDANCAALGEMWRGAGQHYENMVCITIGTGIGGGIIVGRELYRGAHFHAGEFGVMPVGNNGESMHKIASTSGLMASCRQALALPAEEMPPADVIFERMATDVHLREAVNDWARYLSRGVYSVISMFDPGVVLIGGGISEQEKLYPLLTRHLETFEMWEALQVPIQPCQLGNQAGRLGAVWLAQQKLDRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,891,424 | -0.69 | 0.79 | ●○○○○ -0.18 | -0.183135232480053 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,891,242 | -0.54 | 0.84 | ●○○○○ -0.1 | -0.101843371795099 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,891,424 | -0.4 | 0.76 | ●○○○○ -0.03 | -0.033091589626931 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,891,424 | 0.32 | 0.63 | ○○○○○ 0.34 | 0.34208968355696 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,891,242 | 0.78 | 0.34 | ○○○○○ 0.58 | 0.581498281357186 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,891,242 | 1 | 0.63 | ○○○○○ 0.7 | 0.696177986493305 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)