Bacterial taxon 909946
Locus STM474_0526
Protein WP_001172802.1
SDR family oxidoreductase
Salmonella enterica Serovar Typhimurium ST4 74
Length 256 aa, Gene ybbO, UniProt E8X892
>WP_001172802.1|Salmonella enterica Serovar Typhimurium ST4 74|SDR family oxidoreductase
MQKSVLITGCSSGIGLDSALELKRQGFQILAGCRKPDDVARMNSMGFTGVLIDLDSPESVDRAADEVIALTDNRLYGIFNNAGYGVYGPLSTISREQMEQQFSSNFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDALRMELRHTGIKVSLIEPGPIRTRFTDNVNQTQRDKPVENPGIAARFTRDPDAVVAKVRHAFASDKPRLRYPVTLVTWAVMALKRILPGRMLDKILQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 564,904 | 2.71 | 0.00016 | ○○○○○ 1.59 | 1.58534519349611 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 564,904 | 0.54 | 0.68 | ○○○○○ 0.46 | 0.456950422324627 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 564,904 | 0.84 | 0.8 | ○○○○○ 0.61 | 0.613088543862453 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)