Bacterial taxon 909946
Locus STM474_2548
Protein WP_000517460.1
SDR family oxidoreductase UcpA
Salmonella enterica Serovar Typhimurium ST4 74
Length 263 aa, Gene ucpA, UniProt E8XFQ4
>WP_000517460.1|Salmonella enterica Serovar Typhimurium ST4 74|SDR family oxidoreductase UcpA
MGKLTGKTALITGASQGIGEGIARVFARHGANLILLDISDEIEKLADELGGRGHRCTAVKADVRDFASVQAAVARAKETEGRIDILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGDMVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPDDPESVLTEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTLPESVSVGV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,555,055 | -2.7 | 0.011 | ●●○○○ -1.23 | -1.22702849235897 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,555,055 | -0.82 | 0.14 | ●○○○○ -0.25 | -0.247063085650912 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,555,055 | -0.47 | 0.88 | ●○○○○ -0.07 | -0.0664691848827342 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)