Bacterial taxon 909946
Locus STM474_3112
Protein WP_000343990.1
SecY-interacting protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 181 aa, Gene syd, UniProt E8X8Q1
>WP_000343990.1|Salmonella enterica Serovar Typhimurium ST4 74|SecY-interacting protein
MDELTAQALKAFTTRYCDAWQEKHGSWPLSEELYGVPSPCIISSTRDAVYWQPQPFEGEENVNAVERAFDIMVQPALHAFYTTQFAGDMPAQFADEKLTLLQTWSQDDFRRVQENLIGHLVTQKRLKLPPTLFIATQENELEVISVCNLSGEVIKETLGTRNRTVLAATLAEFLTQLNPLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,139,230 | -0.64 | 0.82 | ●○○○○ -0.15 | -0.15445083185608 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,139,230 | 0.49 | 0.71 | ○○○○○ 0.43 | 0.431041535067308 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,139,080 | 0.54 | 0.46 | ○○○○○ 0.46 | 0.455925341281593 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,139,080 | 0.54 | 0.7 | ○○○○○ 0.46 | 0.458785257312137 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,139,230 | 0.83 | 0.28 | ○○○○○ 0.61 | 0.606042767331847 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,139,080 | 1.31 | 0.56 | ○○○○○ 0.86 | 0.855897614984357 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)