Bacterial taxon 909946
Locus STM474_0405
Protein WP_000983569.1
shikimate kinase AroL
Salmonella enterica Serovar Typhimurium ST4 74
Length 181 aa, Gene aroL, UniProt E8XKH2
>WP_000983569.1|Salmonella enterica Serovar Typhimurium ST4 74|shikimate kinase AroL
MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMSVADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCAPVSTLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKAPAQVVSEIIAALPPSTQRLQGDVYT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 440,849 | 0.28 | 0.85 | ○○○○○ 0.32 | 0.323760527554001 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 440,849 | 0.91 | 0.22 | ○○○○○ 0.65 | 0.650981597247712 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 440,849 | 1.32 | 0.56 | ○○○○○ 0.86 | 0.861134823466113 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)