Bacterial taxon 909946
Locus STM474_0334
Protein WP_000174696.1
sigma factor-binding protein Crl
Salmonella enterica Serovar Typhimurium ST4 74
Length 133 aa, Gene crI, UniProt E8XJM1
>WP_000174696.1|Salmonella enterica Serovar Typhimurium ST4 74|sigma factor-binding protein Crl
MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 364,052 | 0.45 | 0.93 | ○○○○○ 0.41 | 0.410422388611121 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 364,052 | 0.85 | 0.27 | ○○○○○ 0.62 | 0.618179508644546 | 23637626 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)