Bacterial taxon 909946
Locus STM474_2459
Protein WP_000168935.1
sigma-54-dependent transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 475 aa, Gene n/a, UniProt E8XF15
>WP_000168935.1|Salmonella enterica Serovar Typhimurium ST4 74|sigma-54-dependent transcriptional regulator
MASTNQELASALRMFSRFFDLIHQPLAVINERGEYVYYNQESADLDGYSIERVMGKHMLDVYPGMKETQSTMLSSLKKGVEYIGHYQIYYNARGQAVDYQHTTAPLYASDGGMVGVIEIGRNMSGVRRLQEQVVELNQLLYADHHEKHHAIITENPEMLSNIAKAKRLAASNIPVTIVGETGTGKELFSRLIHQCSKRANKPFIALNCGALPPTLIESTLFGTVRGAYTGAENSQGYLELANGGTLFLDELNAMPIEMQSKLLRFLQDKTFWRLGGQQQLHSDVRIVAAMNEAPVKLIQQERLRADLFYRLSVGMLTLPPLRARPEDIPLLANYFIDKYRNDVPQDIHGLSETARADLLNHAWPGNVRMLENAIVRSMIMQEKDGLLKHIIFEQDELNLGVPETAPENPLPSSPDPQYEGSLEVRVANYERHLIETALDTHQGNIAAAARSLNVSRTTLQYKVQKYAIRFGVVRN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,471,862 | 1.2 | 0.041 | ○○○○○ 0.8 | 0.801767867424291 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,471,785 | -0.32 | 0.82 | ○○○○○ 0.01 | 0.0121456094468084 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,471,862 | -0.1 | 0.97 | ○○○○○ 0.12 | 0.12289443449568 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,471,785 | 0.26 | 0.65 | ○○○○○ 0.31 | 0.313278571179348 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,471,862 | 0.72 | 0.77 | ○○○○○ 0.55 | 0.553031723392286 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,471,785 | 0.99 | 0.73 | ○○○○○ 0.69 | 0.690591639607782 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)