Bacterial taxon 909946
Locus STM474_2786
Protein WP_000218691.1
site-specific integrase
Salmonella enterica Serovar Typhimurium ST4 74
Length 349 aa, Gene n/a, UniProt E8XIE0
>WP_000218691.1|Salmonella enterica Serovar Typhimurium ST4 74|site-specific integrase
MTVSKQKSGKWLCELYPNGREGRRIRRQFNTKGEAEAFEAFTKSESEDKPWLGKKEDRRRLSEIIQLWHNLHGQALVASKSRLAKLQIVCNGLGDPIASRLTAKDWAHYRDRRLRGEIDNGYHKDPAKWIAKPITVNREQQYLEAVFNELRRLGEWSLPNPLDGIRVFKEAEKEMSWLTLSQLAELFRACEQYGKENLTMIVKVCLATGARWGEAERLTRPQLSPYKLTFTKTKGKKNRTVPIPKWLYDELSERQGRMFKPCYQEFKKMLKLTNIELTEGQKTHVLRHTFGAHFMMNGGNILVLQKILGHANIRETMKYAHFAPDHLEQAVTLNPLSLYVGDNMAAEVA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,815,440 | -1.05 | 0.37 | ●○○○○ -0.37 | -0.366316773608443 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,815,644 | -0.94 | 0.07 | ●○○○○ -0.31 | -0.312694709159638 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,816,392 | 0.07 | 0.93 | ○○○○○ 0.21 | 0.212929632083658 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,816,392 | 0.42 | 0.96 | ○○○○○ 0.4 | 0.395880825973774 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,815,644 | 0.65 | 0.87 | ○○○○○ 0.51 | 0.512520108090299 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,815,440 | 1.12 | 0.67 | ○○○○○ 0.76 | 0.756481598821746 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,815,440 | 1.27 | 0.11 | ○○○○○ 0.84 | 0.835584214551676 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,815,644 | 1.34 | 0.45 | ○○○○○ 0.87 | 0.870847059868241 | 23637626 |
Retrieved 8 of 8 entries in 0.8 ms
(Link to these results)