Bacterial taxon 909946
Locus STM474_2973
Protein WP_001077372.1
sorbitol-6-phosphate dehydrogenase
Salmonella enterica Serovar Typhimurium ST4 74
Length 259 aa, Gene srlD, UniProt E8XK74
>WP_001077372.1|Salmonella enterica Serovar Typhimurium ST4 74|sorbitol-6-phosphate dehydrogenase
MNQVAVVIGGGQTLGAFLCRGLAEEGYRVAVVDIQSDKAANVAQEINADFGEGMAYGFGADATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLLPQYATKLGIKPDEVEQYYIDKVPLKRGCDYQDVLNMLLFYASPKASYCTGQSINVTGGQVMF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,003,534 | -0.04 | 0.98 | ○○○○○ 0.16 | 0.156160112754971 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,003,199 | 0.79 | 0.82 | ○○○○○ 0.59 | 0.588593159614112 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,003,199 | 1.13 | 0.15 | ○○○○○ 0.77 | 0.766528772966556 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,003,481 | 1.22 | 0.66 | ○○○○○ 0.81 | 0.811743342381951 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,003,534 | 1.31 | 0.56 | ○○○○○ 0.86 | 0.855505633115991 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,003,481 | 1.34 | 0.75 | ○○○○○ 0.87 | 0.873990099015038 | 23637626 |
Retrieved 6 of 6 entries in 2.2 ms
(Link to these results)