Bacterial taxon 909946
Locus STM474_1222
Protein WP_000799391.1
spermidine/putrescine ABC transporter permease PotB
Salmonella enterica Serovar Typhimurium ST4 74
Length 287 aa, Gene potB, UniProt E8XFF2
>WP_000799391.1|Salmonella enterica Serovar Typhimurium ST4 74|spermidine/putrescine ABC transporter permease PotB
MKNTSKFQNVVIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYARLLDPLYFEVLLHSLNMALIATLSCLVLGYPFAWFLAKLPEKIRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKMQTFIRIIIPLTMPGIVAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWPFGAATSITLTIVMGLMLLIYWRASRLLNKKVSDISD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,267,411 | -2.99 | 3.3e-9 | ●●○○○ -1.38 | -1.3781996749726 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,267,399 | -1.26 | 0.23 | ●○○○○ -0.47 | -0.474956696882995 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,267,399 | -0.72 | 0.28 | ●○○○○ -0.2 | -0.19699567698761 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,267,402 | -0.34 | 0.59 | ●○○○○ -0 | -0.0000507808742219502 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,267,523 | -0.29 | 0.83 | ○○○○○ 0.02 | 0.0249045744452585 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,267,523 | -0.19 | 0.95 | ○○○○○ 0.08 | 0.0788455765501481 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,267,411 | 0.37 | 0.95 | ○○○○○ 0.37 | 0.367035036355572 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,267,402 | 0.47 | 0.72 | ○○○○○ 0.42 | 0.423432243899634 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,267,945 | 0.57 | 0.89 | ○○○○○ 0.47 | 0.470849544873394 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,267,399 | 0.57 | 0.89 | ○○○○○ 0.47 | 0.474114164425059 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,267,402 | 0.87 | 0.79 | ○○○○○ 0.63 | 0.629860112467387 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,267,945 | 0.89 | 0.77 | ○○○○○ 0.64 | 0.640237881325856 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,267,523 | 1.36 | 0.065 | ○○○○○ 0.88 | 0.883515739405626 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,267,411 | 2.68 | 0.21 | ○○○○○ 1.57 | 1.56749199359076 | 23637626 |
Retrieved 14 of 14 entries in 1.4 ms
(Link to these results)