Bacterial taxon 909946
Locus STM474_3163
Protein WP_000253650.1
sugar porter family MFS transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 472 aa, Gene araE, UniProt E8X9I8
>WP_000253650.1|Salmonella enterica Serovar Typhimurium ST4 74|sugar porter family MFS transporter
MVSINHDSALTPRSLRDTRRMNMFVSVSAAVAGLLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSLGSAFASSVEVLIGARVILGVAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFSYSGNWRAMLGVLALPAVLLIILVVFLPNSPRWLAQKGRHIEAEEVLRMLRDTSEKARDELNEIRESLKLKQGGWALFKANRNVRRAVFLGMLLQAMQQFTGMNIIMYYAPRIFKMAGFTTTEQQMIATLVVGLTFMFATFIAVFTVDKAGRKPALKIGFSVMALGTLVLGYCLMQFDNGTASSGLSWLSVGMTMMCIAGYAMSAAPVVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLTLLDSIGAAGTFWLYTALNIAFIGITFWLIPETKNVTLEHIERKLMAGEKLRNIGV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,197,851 | -2.16 | 0.017 | ●○○○○ -0.94 | -0.944243523732312 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,197,851 | -1.85 | 0.00046 | ●○○○○ -0.78 | -0.783346522559305 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,197,846 | -1.51 | 0.0033 | ●○○○○ -0.61 | -0.6054432318745 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,197,851 | -1.2 | 0.48 | ●○○○○ -0.45 | -0.448477450420568 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,197,541 | 0.08 | 0.97 | ○○○○○ 0.22 | 0.219380142036439 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,197,846 | 0.23 | 0.86 | ○○○○○ 0.3 | 0.297531306203309 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,197,846 | 0.42 | 0.94 | ○○○○○ 0.4 | 0.395124126779283 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,197,550 | 0.47 | 0.92 | ○○○○○ 0.42 | 0.422846466759731 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,197,541 | 0.6 | 0.88 | ○○○○○ 0.49 | 0.490607368913855 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,197,550 | 0.93 | 0.22 | ○○○○○ 0.66 | 0.659262577347761 | 23637626 |
Retrieved 10 of 10 entries in 1.1 ms
(Link to these results)