Bacterial taxon 909946
Locus STM474_2531
Protein WP_000255006.1
sulfate transporter CysZ
Salmonella enterica Serovar Typhimurium ST4 74
Length 253 aa, Gene cysZ, UniProt E8XFN7
>WP_000255006.1|Salmonella enterica Serovar Typhimurium ST4 74|sulfate transporter CysZ
MVSSSTTVPRSGVYYFSQGWKLVTLPGIRRFVILPLLVNIVLMGGAFWWLFTQLDAWIPSLMSHVPDWLQWLSYLLWPIAVISVLLVFGYFFSTLANWIAAPFNGLLAEQLEARLTGATPPDTGILGIMKDVPRIMKREWQKLAWYLPRAIVLLILYFIPGIGQTIAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMRAALRTQKVANMQFGALTSLFTMIPVLNLFIMPVAVCGATAMWVDCWRAKHALWK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,540,267 | -0.82 | 0.49 | ●○○○○ -0.25 | -0.247846559154546 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,540,267 | 1.46 | 0.48 | ○○○○○ 0.94 | 0.935700616978223 | 23637626 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)