Bacterial taxon 909946
Locus STM474_3222
Protein WP_000956930.1
sulfate/molybdate ABC transporter ATP-binding protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 218 aa, Gene cysA, UniProt E8X9P6
>WP_000956930.1|Salmonella enterica Serovar Typhimurium ST4 74|sulfate/molybdate ABC transporter ATP-binding protein
MLTLNQVAYRWPDAAADCLHAISLKLRDGEWLALTGDNGAGKSTLLRIMAGLLSPASGSVTLNGEPIAQLKNRQRAAAIGVLFQEAENQIFHSNVAQEVAFGLKLQRLSAEEISRRTQAALRLCQLTDVAEAHPLDLHAAQRRMVAVASLEAIAPPVLLLDEPSRDFDAHWLTVFEHWLATCRARGTSVVAISHDAAFTRRHFSRVVRLENGRLSKGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,256,730 | 0.07 | 1 | ○○○○○ 0.22 | 0.215764134928945 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,256,481 | 0.39 | 0.94 | ○○○○○ 0.38 | 0.378376757201785 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,256,481 | 0.46 | 0.41 | ○○○○○ 0.42 | 0.415997215538157 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,256,730 | 0.64 | 0.71 | ○○○○○ 0.51 | 0.508222324881262 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,256,730 | 0.97 | 0.1 | ○○○○○ 0.68 | 0.681965420118901 | 23637626 |
Retrieved 5 of 5 entries in 1.4 ms
(Link to these results)