Bacterial taxon 909946
Locus STM474_2043
Protein WP_000515952.1
tail protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 118 aa, Gene n/a, UniProt E8XB31
>WP_000515952.1|Salmonella enterica Serovar Typhimurium ST4 74|tail protein
MGKIAGTTYFKIDGQQLSVTGGIEVPMNTKVRDDVIGLDGSVDYKETSRAPYTKVTAKVPKNFPVDKITSSDVMTITSELANGQVYVLSNAWLHGEANHNPEEGTVDLEFHGEEGFYQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,051,300 | -0.86 | 0.46 | ●○○○○ -0.27 | -0.268712398279895 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,051,300 | -0.01 | 1 | ○○○○○ 0.17 | 0.170536578490972 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,051,300 | 0.75 | 0.33 | ○○○○○ 0.57 | 0.56671278101528 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)