Bacterial taxon 909946
Locus STM474_2702
Protein WP_000447369.1
tail protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 109 aa, Gene n/a, UniProt E8XHH5
>WP_000447369.1|Salmonella enterica Serovar Typhimurium ST4 74|tail protein
METFNWKIRPDMTVESEPKVTSIKLGDGYEQRRPAGLNNHLAKYNVTVRIRKGEHQNLEAFLSRHGGVKSFLWTPPYTWTQIRVICRKWSINVGSLWVTVTTTFEQVVI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,740,739 | 0.35 | 0.82 | ○○○○○ 0.36 | 0.360011164519957 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,740,739 | 0.97 | 0.92 | ○○○○○ 0.68 | 0.678366340074784 | 23637626 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)