Bacterial taxon 909946
Locus STM474_2707
Protein WP_000033885.1
tail protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 133 aa, Gene n/a, UniProt E8XHI0
>WP_000033885.1|Salmonella enterica Serovar Typhimurium ST4 74|tail protein
MSKHTLIRRAVLEKLESVTGAPVTLFDGLPAFVEQEDLPAIAVWLTDAQYTGLMTDEDDWQATLHTAVFLRAQAPDTELDIWMEEKIFPALEEVSGLERLIDTMTPLGYDYQRDSEMATWGMAEITYRITYTN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,745,848 | -0.41 | 0.75 | ●○○○○ -0.04 | -0.0364374855678562 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,745,848 | -0.19 | 0.75 | ○○○○○ 0.08 | 0.0803965738443464 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,745,848 | 0.58 | 0.89 | ○○○○○ 0.48 | 0.478622686587081 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)