Bacterial taxon 909946
Locus STM474_1620
Protein WP_000218280.1
tellurite resistance methyltransferase TehB
Salmonella enterica Serovar Typhimurium ST4 74
Length 198 aa, Gene tehB, UniProt E8XJT8
>WP_000218280.1|Salmonella enterica Serovar Typhimurium ST4 74|tellurite resistance methyltransferase TehB
MTVRDENYFTEKYGLTRTHSDVLAAAKVVAPGRTLDLGCGNGRNSLYLAANGYDVTAWDKNPASMANLERIKAAEGLDNLQTDLVDLNTLTFDGEYDFILSTVVMMFLEAQTIPGLIANMQRCTKPGGYNLIVAAMDTPDFPCTVGFPFAFKEGELRRYYEGWDMLKYNEDVGELHRTDENGNRIKLRFATMLARKTA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,655,608 | 0.25 | 0.97 | ○○○○○ 0.31 | 0.306092330402623 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,655,608 | 0.25 | 1 | ○○○○○ 0.31 | 0.307965659074617 | 23637626 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)