Bacterial taxon 909946
Locus STM474_2718
Protein WP_001102153.1
terminase small subunit
Salmonella enterica Serovar Typhimurium ST4 74
Length 181 aa, Gene n/a, UniProt E8XHJ1
>WP_001102153.1|Salmonella enterica Serovar Typhimurium ST4 74|terminase small subunit
MNVNKKKLAEIFGCDVRTVTAWQSQGLPLVSGGGKGNEAVFDTAAAISWYAERDASIENEKLRKEVDDLRAAAESDLNPGTIDYERYRLTKAQADAQELKNAEREGLVLETELFTYILQRVAQEIAGILSRVPLVLQRKYPDLCQSHIDVVRTEIARASGRAATIADVEKWTDDFRRAQGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,755,275 | -3.25 | 3.4e-7 | ●●○○○ -1.51 | -1.51297753912977 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,755,275 | -1.29 | 0.43 | ●○○○○ -0.49 | -0.49202984972325 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,755,275 | -1.15 | 0.31 | ●○○○○ -0.42 | -0.418608384377993 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)