Bacterial taxon 909946
Locus STM474_1390
Protein WP_000269830.1
tetrathionate reductase subunit TtrB
Salmonella enterica Serovar Typhimurium ST4 74
Length 250 aa, Gene ttrB, UniProt E8XH79
>WP_000269830.1|Salmonella enterica Serovar Typhimurium ST4 74|tetrathionate reductase subunit TtrB
MWTGVNMDSSKRQFLQQLGVLTAGASLVPLAEAKFPFSPERHEGSPRHRYAMLIDLRRCIGCQSCTVSCTIENQTPQGAFRTTVNQYQVQREGSQEVTNVLLPRLCNHCDNPPCVPVCPVQATFQREDGIVVVDNKRCVGCAYCVQACPYDARFINHETQTADKCTFCVHRLEAGLLPACVESCVGGARIIGDIKDPHSRIATMLHQHRDAIKVLKPENGTSPHVFYLGLDDAFVTPLMGRAQPALWQEV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,427,494 | -1.53 | 0.0034 | ●○○○○ -0.62 | -0.619239094922492 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,427,494 | -0.75 | 0.76 | ●○○○○ -0.21 | -0.212271182967626 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,427,494 | 0 | 1 | ○○○○○ 0.18 | 0.178259282800874 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)