Bacterial taxon 909946
Locus STM474_4346
Protein WP_000944073.1
thiazole synthase
Salmonella enterica Serovar Typhimurium ST4 74
Length 256 aa, Gene thiG, UniProt E8XLA6
>WP_000944073.1|Salmonella enterica Serovar Typhimurium ST4 74|thiazole synthase
MLRIADKTFDSHLFTGTGKFASSQLMVEAIRASGSQLVTLAMKRVDLRQHNDAILAPLIEAGVTLLPNTSGAKTAEEAIFAAQLAREALGTHWLKLEIHPDARWLLPDPIETLKAAEALVKQGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLETKAMLEIIIQQSTVPVVVDAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVMMATAFRLAVEAGVLARQAVPGNRSTYANATSPLTGFLEALA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,399,728 | 2.03 | 0.0092 | ○○○○○ 1.23 | 1.23128628481168 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,399,703 | -1.81 | 0.055 | ●○○○○ -0.77 | -0.765148402124365 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,399,703 | -0.18 | 0.82 | ○○○○○ 0.08 | 0.0813148131536496 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,400,214 | 0.03 | 0.99 | ○○○○○ 0.19 | 0.191344227363045 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,399,728 | 0.05 | 1 | ○○○○○ 0.2 | 0.200636923422432 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,400,214 | 0.1 | 1 | ○○○○○ 0.23 | 0.231347296452702 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,399,703 | 0.54 | 0.9 | ○○○○○ 0.46 | 0.456054684922246 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,400,214 | 0.75 | 0.41 | ○○○○○ 0.57 | 0.56825803157276 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,399,728 | 2.87 | 0.15 | ○○○○○ 1.67 | 1.66763556916015 | 23637626 |
Retrieved 9 of 9 entries in 1.1 ms
(Link to these results)