Bacterial taxon 909946
Locus STM474_4176
Protein WP_000725364.1
thiol:disulfide interchange protein DsbA
Salmonella enterica Serovar Typhimurium ST4 74
Length 207 aa, Gene dsbA, UniProt E8XJI0
>WP_000725364.1|Salmonella enterica Serovar Typhimurium ST4 74|thiol:disulfide interchange protein DsbA
MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHVEFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,225,999 | -5.17 | 5.8e-6 | ●●●○○ -2.51 | -2.50615724806214 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,225,999 | -3.1 | 0.00079 | ●●○○○ -1.43 | -1.43079411062034 | 23637626 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)