Bacterial taxon 909946
Locus STM474_3347
Protein WP_000096230.1
thiol:disulfide interchange protein DsbA/DsbL
Salmonella enterica Serovar Typhimurium ST4 74
Length 223 aa, Gene dsbL, UniProt E8XBC2
>WP_000096230.1|Salmonella enterica Serovar Typhimurium ST4 74|thiol:disulfide interchange protein DsbA/DsbL
MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTFTPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQADFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,377,537 | -0.45 | 0.72 | ●○○○○ -0.05 | -0.0547266091568087 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,377,537 | 0.2 | 0.98 | ○○○○○ 0.28 | 0.282479993062791 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,377,537 | 0.23 | 0.69 | ○○○○○ 0.3 | 0.298410737642721 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)