Bacterial taxon 909946
Locus STM474_2594
Protein WP_001068686.1
thioredoxin-dependent thiol peroxidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 156 aa, Gene bcp, UniProt E8XGI2
>WP_001068686.1|Salmonella enterica Serovar Typhimurium ST4 74|thioredoxin-dependent thiol peroxidase
MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,603,501 | -0.16 | 0.96 | ○○○○○ 0.1 | 0.095496179099531 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,603,501 | 0.65 | 0.35 | ○○○○○ 0.52 | 0.516274680829287 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,603,501 | 0.66 | 0.59 | ○○○○○ 0.52 | 0.518145817993152 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)