Bacterial taxon 909946
Locus STM474_2149
Protein WP_001016236.1
thiosulfate reductase electron transport protein PhsB
Salmonella enterica Serovar Typhimurium ST4 74
Length 192 aa, Gene phsB, UniProt E8XC18
>WP_001016236.1|Salmonella enterica Serovar Typhimurium ST4 74|thiosulfate reductase electron transport protein PhsB
MNHLTNQYVMLHDEKRCIGCQACTVACKVLNDVPEGFSRVQVQIRAPEQASNALTHFQFVRVSCQHCENAPCVSVCPTGASYRDENGIVQVDKSRCIGCDYCVAACPFHVRYLNPQTGVADKCNFCADTRLAAGQSPACVSVCPTDALKFGRLDESEIQRWVGQKEVYRQQEARSGAVSLYRRKEVHQEGKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,136,310 | -0.93 | 0.45 | ●○○○○ -0.3 | -0.303433450855602 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,136,310 | 0.5 | 0.52 | ○○○○○ 0.44 | 0.438291601181362 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,136,310 | 0.6 | 0.88 | ○○○○○ 0.49 | 0.486232818525291 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)