Bacterial taxon 909946
Locus STM474_4137
Protein WP_000980080.1
threonine export protein RhtC
Salmonella enterica Serovar Typhimurium ST4 74
Length 206 aa, Gene rhtC, UniProt E8XJE7
>WP_000980080.1|Salmonella enterica Serovar Typhimurium ST4 74|threonine export protein RhtC
MMMLFFTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGLHLIIEKMAWLHTIIMVGGGLYLCWMGYQMLRGALKKQDAAASSPHIELAQSGRSFLKGLLTNLSNPKAIIYFGSVFSLFVGDNVGAAARWGIFALITLETLAWFTVVASLFALPKMRRGYQRLAKWIDGFAGALFAGFGIHLIISR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,186,254 | 1.91 | 0.019 | ○○○○○ 1.17 | 1.16845589009603 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,186,163 | -0.33 | 0.58 | ○○○○○ 0 | 0.00406107000749125 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,186,254 | 0.23 | 0.88 | ○○○○○ 0.3 | 0.2964632061673 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,186,163 | 0.39 | 0.94 | ○○○○○ 0.38 | 0.379992947188976 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,186,254 | 0.57 | 0.89 | ○○○○○ 0.47 | 0.470828892246199 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,186,163 | 1.76 | 0.41 | ○○○○○ 1.09 | 1.09264021250659 | 23637626 |
Retrieved 6 of 6 entries in 0.7 ms
(Link to these results)