Bacterial taxon 909946
Locus STM474_0004
Protein WP_000781105.1
threonine synthase
Salmonella enterica Serovar Typhimurium ST4 74
Length 428 aa, Gene thrC, UniProt E8XG24
>WP_000781105.1|Salmonella enterica Serovar Typhimurium ST4 74|threonine synthase
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEIDEMLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAALRKLMMTRQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,303 | -0.41 | 0.52 | ●○○○○ -0.03 | -0.0342193329588091 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,303 | 0.73 | 0.84 | ○○○○○ 0.56 | 0.556048202425343 | 23637626 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)