Bacterial taxon 909946
Locus STM474_4280
Protein WP_000792788.1
TIGR02117 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 220 aa, Gene n/a, UniProt E8XKG5
>WP_000792788.1|Salmonella enterica Serovar Typhimurium ST4 74|TIGR02117 family protein
MKNLFIAWISLLLYGCTTFPQAVKPTTGGQPSPTEIYIVSHGWHTGIIAPAHDVNTVLPQLKKRFAQETQWYEIGWGDKGFYQSQEITTALTLQAMFWSSGAVMHIVAFSGQPERYFVGSEIKSLLLHTNQRNSLMRYLGRSFARDEGGNLIPLKQGIYGDSQFYAANGRYGILNTCNKWTAKGLESAGLTINPSLKLTAGSVMKAITDHRMCLNKYCYP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,327,491 | -0.45 | 0.88 | ●○○○○ -0.06 | -0.0556249208022687 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,327,842 | 0.23 | 0.98 | ○○○○○ 0.29 | 0.294605410198653 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,327,923 | 0.33 | 0.97 | ○○○○○ 0.35 | 0.347037097286224 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,327,923 | 0.37 | 0.81 | ○○○○○ 0.37 | 0.371718331290849 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,327,491 | 0.87 | 0.25 | ○○○○○ 0.63 | 0.629775489614055 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,327,923 | 1.33 | 0.092 | ○○○○○ 0.87 | 0.867155141931198 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,327,842 | 2.43 | 0.19 | ○○○○○ 1.44 | 1.43949878050026 | 23637626 |
Retrieved 7 of 7 entries in 1.2 ms
(Link to these results)