Bacterial taxon 909946
Locus STM474_2813
Protein WP_000533859.1
TolC family type I secretion outer membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 469 aa, Gene n/a, UniProt E8XIG7
>WP_000533859.1|Salmonella enterica Serovar Typhimurium ST4 74|TolC family type I secretion outer membrane protein
MGRVAPVAIVLAFALFHHQPRGAEAPPMITSEGLATDQMLPSLDGSAAELPLSAAAPGNLTLNDAVNRAVNWHPSIREAIGKLLAQNEQIEVAKSKYYPQVSPGVNNGYSNTYTDHGYSPSLVLSVSQMLYDFGKVASQVRAETAGAAQQQANVLLSIDTVAHETANAIVQTQSWQQMVEAAEEQLVALDSIGKLIRQRSDEGATSLSDVVQTEARIESARSQLAQYQANLDSAKASLMSWLGWNSLNGINNDFPAKLARSCETATPDDRLVPAVLAAWAQANVARANLDYASAQMTPTISLEPSVQHYLNDKYPSHEVLDKTQYSTWVKVEMPLYQGGGLTARRNAASHAVDAAQSTIQRTRLDVRQKLMEARSQAMSLASALQILRRQQQLSERTRELYQQQYLDLGSRPLLDVLNAEQEVYQARFAELQTESQLHQLQLNCLYNTGALRQAFALNHRSIQSVEIQP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,851,178 | 2.41 | 0.00096 | ○○○○○ 1.43 | 1.42879217740505 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,851,646 | 2.92 | 0.00021 | ○○○○○ 1.69 | 1.69285774371018 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,850,932 | 0.68 | 0.58 | ○○○○○ 0.53 | 0.528990746796463 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,850,932 | 0.69 | 0.17 | ○○○○○ 0.53 | 0.533575971223671 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,851,646 | 0.73 | 0.54 | ○○○○○ 0.56 | 0.558712965176351 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,850,932 | 0.85 | 0.79 | ○○○○○ 0.62 | 0.619642385500757 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,850,999 | 1 | 0.1 | ○○○○○ 0.7 | 0.696153142996299 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,851,178 | 1.02 | 0.4 | ○○○○○ 0.71 | 0.707562922633458 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,850,999 | 1.1 | 0.39 | ○○○○○ 0.75 | 0.747671230332297 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,850,999 | 1.29 | 0.57 | ○○○○○ 0.85 | 0.845245147852376 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,851,646 | 1.52 | 0.44 | ○○○○○ 0.97 | 0.965241144793439 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,851,178 | 1.8 | 0.3 | ○○○○○ 1.11 | 1.11367402138233 | 23637626 |
Retrieved 12 of 12 entries in 1.7 ms
(Link to these results)