Bacterial taxon 909946
Locus STM474_0043
Protein WP_000062872.1
transcriptional activator NhaR
Salmonella enterica Serovar Typhimurium ST4 74
Length 299 aa, Gene nhaR, UniProt E8XG62
>WP_000062872.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional activator NhaR
MSMSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALEERLQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADALSKRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLFSVKIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQVEILGEFDDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAERMIQHPAVQRICNADYSALFKLQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 48,224 | -0.79 | 0.31 | ●○○○○ -0.23 | -0.231577034941617 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 47,600 | -0.64 | 0.61 | ●○○○○ -0.15 | -0.152930557740175 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 48,224 | -0.59 | 0.63 | ●○○○○ -0.13 | -0.130487396738034 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 47,600 | -0.27 | 0.94 | ○○○○○ 0.04 | 0.0372303063296825 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 47,600 | 0.02 | 0.97 | ○○○○○ 0.19 | 0.189445921730161 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 48,224 | 0.52 | 0.91 | ○○○○○ 0.45 | 0.446926526981564 | 23637626 |
Retrieved 6 of 6 entries in 2 ms
(Link to these results)