Bacterial taxon 909946
Locus STM474_3618
Protein WP_000091471.1
transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 240 aa, Gene yheO, UniProt E8XDZ7
>WP_000091471.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator
MSRSLLTNETSELDLLDQRPFEQTDFDILKSYEAVVDGLAMLIGSHCEIVLHSLQDLKCSAIRIANGEHTGRKIGSPITDLALRMLHDMTGADSSVSKCYFTRAKSGVLMKSLTIAIRNREQRVIGLLCINMNLDVPFSQIMNTFIPPETPEVGSAVNFASSVEDLVTQTLEFTIEEVNADRNVSNNAKNRQIVLNLYEKGIFDIKDAINQVADRLNISKHTVYLYIRQFKSGDFQGQDK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,625,543 | -1.25 | 0.44 | ●○○○○ -0.47 | -0.472994669775728 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,625,543 | -0.39 | 0.62 | ●○○○○ -0.03 | -0.0250776307708518 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,625,543 | 0.05 | 0.98 | ○○○○○ 0.2 | 0.202109718670526 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)