Bacterial taxon 909946
Locus STM474_4519
Protein WP_001188509.1
transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 191 aa, Gene yjdC, UniProt E8X9X3
>WP_001188509.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator
MQREDILGEALKLLETQGIADTTLEMVAERVNRPLDTLQRFWPDKEAILYDALRYLSQQVDIWRRQLLLDETLSAEQKLLARYSALSECVSNNRYPGCLFIAACTFYPDPTHPIHQLANQQKRAAHDFTHELLTTLEIDDPAMVARQMELVLEGCLSRMLVNRSQADVDTAQRLAEDILRFAQCRQGGALT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,587,425 | 1.17 | 0.5 | ○○○○○ 0.78 | 0.782348881699393 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,587,425 | 1.31 | 0.59 | ○○○○○ 0.86 | 0.857952378198864 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,587,425 | 1.89 | 0.099 | ○○○○○ 1.16 | 1.1588613444315 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)