Bacterial taxon 909946
Locus STM474_4599
Protein WP_001201297.1
transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 128 aa, Gene ytfH, UniProt E8XAS7
>WP_001201297.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator
MRAHTLSRQLREGNLFAEQCPSREVLKHVTSRWGVLILVALRDGTHRFSDLRRKMGGVSEKMLAQSLQALEQDGFLNRVSYPVVPPHVEYSLTPLGEQVSDKVAALADWIELNLPQVLAQRERLSDGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,660,026 | -1.87 | 0.073 | ●○○○○ -0.79 | -0.794700200627002 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,660,026 | -0.96 | 0.11 | ●○○○○ -0.32 | -0.323336086325722 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,660,048 | 0.08 | 1 | ○○○○○ 0.22 | 0.218926058436308 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,660,048 | 0.84 | 0.3 | ○○○○○ 0.62 | 0.61517736737166 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,660,048 | 1.34 | 0.58 | ○○○○○ 0.87 | 0.873084909565394 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,660,026 | 1.54 | 0.66 | ○○○○○ 0.98 | 0.978751102236895 | 23637626 |
Retrieved 6 of 6 entries in 1.7 ms
(Link to these results)