Bacterial taxon 909946
Locus STM474_2974
Protein WP_000255198.1
transcriptional regulator GutM
Salmonella enterica Serovar Typhimurium ST4 74
Length 119 aa, Gene gutM, UniProt E8XK75
>WP_000255198.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator GutM
MVSTLITVAVIAWCAQLALGGWQISRFNRAFDKLSQQGRVGVGRSGGRFKPRVVVAVALDEQQRVTDTLLMKGLTVFARPVKIAAMQGKHLHELQPDVIFPHDSLAQNALSLALKLKHG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,003,985 | 1.78 | 0.034 | ○○○○○ 1.1 | 1.10373206299686 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,003,985 | 1.15 | 0.81 | ○○○○○ 0.77 | 0.772735336905742 | 23637626 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)