Bacterial taxon 909946
Locus STM474_4493
Protein WP_000106992.1
transcriptional regulator MelR
Salmonella enterica Serovar Typhimurium ST4 74
Length 310 aa, Gene melR, UniProt E8X9U8
>WP_000106992.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator MelR
MSTQAISLLPPDPHMCNGDEKQTRSPLSLYSEYQRLDVELRPPHRMASSHWHGQVEVNVPFDGDVEYLINNEVVQIKQGHITLFWACTPHQLTRPGNCRQMAIFSLPMHLFLSWPLDRDLINHVTHGMVVKSLATQQLSTFEVLRWQQETSSPNEQIRQLAIDEIGLMLKRFSLSGWQPILLNKTSRTHKNSVSRHAQFYVSQMLGFIADNYDQALTINDVAEHVKLNANYAMGIFQRVMQLTMKQYITAMRINHVRALLSDTDKTILDVALTAGFRSSSRFYSTFSKFVGMSPQQYRKLSQQRRQTMPG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,562,741 | 1.47 | 0.048 | ○○○○○ 0.94 | 0.942721251925173 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,562,769 | -0.74 | 0.13 | ●○○○○ -0.21 | -0.207005242879538 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,562,639 | 0.04 | 0.97 | ○○○○○ 0.2 | 0.196431809329035 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,562,769 | 0.07 | 1 | ○○○○○ 0.21 | 0.212268178844461 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,562,639 | 0.38 | 0.82 | ○○○○○ 0.37 | 0.374077102901802 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,562,741 | 0.47 | 0.79 | ○○○○○ 0.42 | 0.423525283805987 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,562,769 | 0.53 | 0.75 | ○○○○○ 0.45 | 0.452921313338321 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,562,741 | 0.58 | 0.89 | ○○○○○ 0.48 | 0.478106715732166 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,562,639 | 1.29 | 0.57 | ○○○○○ 0.84 | 0.84483333543202 | 23637626 |
Retrieved 9 of 9 entries in 0.9 ms
(Link to these results)