Bacterial taxon 909946
Locus STM474_0435
Protein WP_000543533.1
transcriptional regulator NrdR
Salmonella enterica Serovar Typhimurium ST4 74
Length 149 aa, Gene nrdR, UniProt E8XKK2
>WP_000543533.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator NrdR
MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVIKSNDVREPFNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATGEREVPSKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKDFGEEIARLQD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 469,171 | -3.69 | 0.00039 | ●●○○○ -1.74 | -1.73917804155523 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 469,171 | -2.41 | 0.022 | ●●○○○ -1.07 | -1.07238255883891 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 469,171 | -0.12 | 0.88 | ○○○○○ 0.11 | 0.114720988895201 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)